PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_7DL_68B814464.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family bZIP
Protein Properties Length: 164aa    MW: 17738.3 Da    PI: 10.5187
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_7DL_68B814464.1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_150.74e-1684146163
                            XXXXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                 bZIP_1   1 ekelkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
                            +ke +r +r+ +NR++A+  R+RKka++ eLe kvk Le+ N++L ++l++l++e + lk+ +
  Traes_7DL_68B814464.1  84 DKEHRRLKRLLRNRVSAQQARERKKAYMGELEVKVKDLETRNSELEERLSTLQNENQMLKQIL 146
                            58899*****************************************************99965 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003381.0E-1684148IPR004827Basic-leucine zipper domain
PfamPF001706.4E-1585146IPR004827Basic-leucine zipper domain
PROSITE profilePS5021712.43886149IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1705.3E-1888148No hitNo description
SuperFamilySSF579594.56E-1488146No hitNo description
PROSITE patternPS00036091106IPR004827Basic-leucine zipper domain
CDDcd147046.42E-1498140No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009737Biological Processresponse to abscisic acid
GO:0009740Biological Processgibberellic acid mediated signaling pathway
GO:0010017Biological Processred or far-red light signaling pathway
GO:0010099Biological Processregulation of photomorphogenesis
GO:0010114Biological Processresponse to red light
GO:0010218Biological Processresponse to far red light
GO:0010224Biological Processresponse to UV-B
GO:0031539Biological Processpositive regulation of anthocyanin metabolic process
GO:0042753Biological Processpositive regulation of circadian rhythm
GO:0080167Biological Processresponse to karrikin
GO:0005634Cellular Componentnucleus
GO:0003690Molecular Functiondouble-stranded DNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding